PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G222100.1.p
Common NameGLYMA_15G222100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 370aa    MW: 41577.7 Da    PI: 5.1818
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G222100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR131.65.6e-1064108145
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeek 45 
                          +fYn+YA++vGFs+ + + ++ k +g i++ +f Cs+e +++++ 
  Glyma.15G222100.1.p  64 SFYNAYARHVGFSTHVGQFNRAKPDGPIITWDFACSREVFKRKNI 108
                          5***************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.6E-864109IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDVEAVDEGE NSDRPVSENV ETGKGQEQNM TVNLAEREVN NQNGDAYRKP QVGMLFESED  60
AAKSFYNAYA RHVGFSTHVG QFNRAKPDGP IITWDFACSR EVFKRKNITI IPLFFRQYER  120
SLEHSLEKEI EADYETICNT PVLKTPSPME QQAANMYTKK IFAKFQEELV ETFAYTANNV  180
EDDGVISKYR VAKYVHDHKA YMVTLNISEM KVNCSCQMNA KSDIGTDEKI TDPIDIENLT  240
VRFNSLCREA IKLAEEGAVS VETYNATMNA LREGAKRVGI MKKNVAKVTP PNTQGNGSCL  300
KDHSKNSPSS ISDVIPSLWP WQDSVSHHFN LNDLGLPVTD LNTPSMAPVS IHRDGCPYLF  360
QVYDLDHLK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.385070.0meristem| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-137AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530369.11e-157PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1
RefseqXP_006585693.11e-157PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X2
RefseqXP_014634675.11e-157PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1
RefseqXP_014634676.11e-157PREDICTED: protein FAR1-RELATED SEQUENCE 3-like isoform X1
SwissprotQ9ZVC92e-74FRS3_ARATH; Protein FAR1-RELATED SEQUENCE 3
TrEMBLA0A0R0G4L30.0A0A0R0G4L3_SOYBN; Uncharacterized protein
STRINGGLYMA15G34840.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27110.21e-75FAR1-related sequence 3